Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
C-X-C motif chemokine 2 (CXCL2)
|
|||
Synonyms |
SCYB2; Macrophage inflammatory protein 2-alpha; MIP2A; MIP2-alpha; Growth-regulated protein beta; Growth regulatedprotein beta; Gro-beta; GROB; GRO2
|
|||
Gene Name |
CXCL2
|
|||
Gene ID | ||||
Sequence |
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN Click to Show/Hide
|
|||
Function |
Hematoregulatory chemokine, which, in vitro, suppresses hematopoietic progenitor cell proliferation. GRO-beta(5-73) shows a highly enhanced hematopoietic activity. Produced by activated monocytes and neutrophils and expressed at sites of inflammation.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Urolithin A NP Info | + | Cisplatin Drug Info | |
Structure | + |
References | ||||
---|---|---|---|---|
Reference 1 | Protective effect of urolithin a on cisplatin-induced nephrotoxicity in mice via modulation of inflammation and oxidative stress. Food Chem Toxicol. 2019 Jul;129:108-114. |