Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Platelet endothelial cell adhesion molecule (PECAM1)
|
|||
Synonyms |
PECAM-1; PECA1; GPIIA'; EndoCAM; ECAM; CD31 antigen; CD31
|
|||
Gene Name |
PECAM1
|
|||
Gene ID | ||||
Sequence |
MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFAD
VSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTT AEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKRE KNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHI SPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHNRHGNKAVYSVMAMVEHSG NYTCKVESSRISKVSSIVVNITELFSKPELESSFTHLDQGERLNLSCSIPGAPPANFTIQ KEDTIVSQTQDFTKIASKSDSGTYICTAGIDKVVKKSNTVQIVVCEMLSQPRISYDAQFE VIKGQTIEVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADN CHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREK EGKPFYQMTSNATQAFWTKQKASKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWK KGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEAN SHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAV PDAVESRYSRTEGSLDGT Click to Show/Hide
|
|||
Function |
Cell adhesion molecule which is required for leukocyte transendothelial migration (TEM) under most inflammatory conditions. Tyr-690 plays a critical role in TEM and is required for efficient trafficking of PECAM1 to and from the lateral border recycling compartment (LBRC) and is also essential for the LBRC membrane to be targeted around migrating leukocytes. Trans-homophilic interaction may play a role in endothelial cell-cell adhesion via cell junctions. Heterophilic interaction with CD177 plays a role in transendothelial migration of neutrophils. Homophilic ligation of PECAM1 prevents macrophage-mediated phagocytosis of neighboring viable leukocytes by transmitting a detachment signal. Promotes macrophage-mediated phagocytosis of apoptotic leukocytes by tethering them to the phagocytic cells; PECAM1-mediated detachment signal appears to be disabled in apoptotic leukocytes. Modulates bradykinin receptor BDKRB2 activation. Regulates bradykinin- and hyperosmotic shock-induced ERK1/2 activation in endothelial cells. Induces susceptibility to atherosclerosis (By similarity); [Isoform Delta15]: Does not protect against apoptosis.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Honokiol NP Info | + | Celecoxib Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Capecitabine Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Fisetin NP Info | + | Cabazitaxel Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ginsenoside Rg3 NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Honokiol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Fisetin NP Info | + | Cyclophosphamide Drug Info | |
Structure | + | |||
Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ursolic acid NP Info | + | Capecitabine Drug Info | |
Structure | + | |||
Drug Combination 9 Down-regulating the Expression of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ginsenoside Rg3 NP Info | + | Cyclophosphamide Drug Info | |
Structure | + |