Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Transcription factor HES-1 (HES1)
|
|||
Synonyms |
Class B basic helix-loop-helix protein 39; bHLHb39; Hairy and enhancer of split 1; Hairy homolog; Hairy-like protein; hHL
|
|||
Gene Name |
HES1
|
|||
Gene ID | ||||
Sequence |
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN Click to Show/Hide
|
|||
Function |
Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity (By similarity). May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Eugenol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Elemene NP Info | + | Gefitinib Drug Info | |
Structure | + |