Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
T-cell surface glycoprotein CD8 alpha (CD8A)
|
|||
Synonyms |
T-lymphocyte differentiation antigen T8/Leu-2; CD8a
|
|||
Gene Name |
CD8A
|
|||
Gene ID | ||||
Sequence |
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV Click to Show/Hide
|
|||
Function |
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule:peptide complex. The antigens presented by class I peptides are derived from cytosolic proteins while class II derived from extracellular proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK then initiates different intracellular signaling pathways by phosphorylating various substrates ultimately leading to lymphokine production, motility, adhesion and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing conjugation and lysis of multiple target cells. CD8A homodimer molecules also promote the survival and differentiation of activated lymphocytes into memory CD8 T-cells.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID |
Drug(s) of This Target | ||||
---|---|---|---|---|
1 | Anti-CD8 (53.6.72) antibody | Drug Info | Phase 2 | Solid tumour/cancer |
References | ||||
---|---|---|---|---|
Reference 1 | Pancreatic islet xenograft survival in mice is extended by a combination of alpha-1-antitrypsin and single-dose anti-CD4/CD8 therapy. PLoS One. 2013 May 22;8(5):e63625. |