Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
NF-kappa-B inhibitor alpha (NFKBIA)
|
|||
Synonyms |
I-kappa-B-alpha; IkB-alpha; IkappaBalpha; Major histocompatibility complex enhancer-binding protein MAD3
|
|||
Gene Name |
NFKBIA
|
|||
Gene ID | ||||
Sequence |
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE DELPYDDCVFGGQRLTL Click to Show/Hide
|
|||
Function |
Inhibits the activity of dimeric NF-kappa-B/REL complexes by trapping REL dimers in the cytoplasm through masking of their nuclear localization signals. On cellular stimulation by immune and proinflammatory responses, becomes phosphorylated promoting ubiquitination and degradation, enabling the dimeric RELA to translocate to the nucleus and activate transcription.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gambogic acid NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Noscapine NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gambogic acid NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Expression of This Molecule | [12] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Mitomycin C Drug Info | |
Structure | + | |||
Phosphorylation Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Phosphorylation of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Phosphorylation of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Carfilzomib Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Phosphorylation of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Wogonin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Phosphorylation of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Silibinin NP Info | + | Indole-3-carbinol Drug Info | |
Structure | + | |||
Drug Combination 5 Down-regulating the Phosphorylation of This Molecule | [8] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Lenalidomide Drug Info | |
Structure | + | |||
Drug Combination 6 Down-regulating the Phosphorylation of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | Bortezomib Drug Info | |
Structure | + | |||
Drug Combination 7 Down-regulating the Phosphorylation of This Molecule | [10] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Honokiol NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 8 Down-regulating the Phosphorylation of This Molecule | [11] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Capsaicin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Phosphorylation of This Molecule | [13] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Celastrol NP Info | + | Temozolomide Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Phosphorylation of This Molecule | [14] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Flavopiridol NP Info | + | Bortezomib Drug Info | |
Structure | + |