Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Glycoprotein hormones alpha (CGA)
|
|||
Synonyms |
Thyrotropin alpha chain; Thyroid-stimulating hormone alpha chain; TSH-alpha; Lutropin alpha chain; Luteinizing hormone alpha chain; LSH-alpha; Glycoprotein hormones alpha chain; Follitropin alpha chain; Follicle-stimulating hormone alpha chain; FSH-alpha; Chorionic gonadotrophin subunit alpha; Choriogonadotropin alpha chain; CG-alpha; Anterior pituitary glycoprotein hormones common subunit alpha
|
|||
Gene Name |
CGA
|
|||
Gene ID | ||||
Sequence |
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS Click to Show/Hide
|
|||
Function |
Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH, follitropin/follicle stimulating hormone/FSH and choriogonadotropin/CG. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + |