Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Bcl-2-binding component 3 (BBC3)
|
|||
Synonyms |
JFY-1; p53 up-regulated modulator of apoptosis
|
|||
Gene Name |
BBC3
|
|||
Gene ID | ||||
Sequence |
MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLP
ARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAP RPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGG RPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS GGRPLPPPDTLASAGDFLCTM Click to Show/Hide
|
|||
Function |
Does not affect cell growth.
Click to Show/Hide
|
|||
Uniprot ID | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Venetoclax Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Carnosic acid NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 3 Up-regulating the Expression of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Apigenin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 4 Up-regulating the Expression of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Dasatinib Drug Info | |
Structure | + | |||
Drug Combination 5 Up-regulating the Expression of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Wogonin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 6 Up-regulating the Expression of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 7 Up-regulating the Expression of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Wogonin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 8 Up-regulating the Expression of This Molecule | [8] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 9 Up-regulating the Expression of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Capsaicin NP Info | + | 3,3'-diindolylmethane Drug Info | |
Structure | + |