Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
NADH-ubiquinone oxidoreductase B8 (NDUFA2)
|
|||
Synonyms |
Complex I-B8; CI-B8; NADH-ubiquinone oxidoreductase B8 subunit; NADH dehydrogenase [ubiquinone] 1 alpha 2
|
|||
Gene Name |
NDUFA2
|
|||
Gene ID | ||||
Sequence |
MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSD
VQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA Click to Show/Hide
|
|||
Function |
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Gefitinib Drug Info | |
Structure | + |
References | ||||
---|---|---|---|---|
Reference 1 | Gefitinib enhances arsenic trioxide (AS2O3)-induced differentiation of acute promyelocytic leukemia cell line. Leuk Res. 2010 Nov;34(11):1501-5. |