Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Protein eIF4E-binding 1 (EIF4EBP1)
|
|||
Synonyms |
Eukaryotic translation initiation factor 4E-binding protein 1; Phosphorylated heat- andacid-stable protein regulated by insulin 1; Phosphorylated heat- and acid-stable protein regulated by insulin 1; PHAS-I; 4E-BP1; eIF4E-binding protein 1
|
|||
Gene Name |
EIF4EBP1
|
|||
Gene ID | ||||
Sequence |
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLM
ECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI Click to Show/Hide
|
|||
Function |
In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Vinblastine NP Info | + | Temsirolimus Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Phosphorylation Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Phosphorylation of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Phosphorylation of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Silibinin NP Info | + | Regorafenib Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Phosphorylation of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Everolimus Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Phosphorylation of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | BIIB021 Drug Info | |
Structure | + |