Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Macrophage-derived chemokine (MDC)
|
|||
Synonyms |
Stimulated T-cell chemotactic protein 1; Stimulated T cell chemotactic protein1; Small-inducible cytokine A22; SCYA22; MDC(1-69); CC chemokine STCP-1; C-C motif chemokine 22; A-152E5.1
|
|||
Gene Name |
CCL22
|
|||
Gene ID | ||||
Sequence |
MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSC
PRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ Click to Show/Hide
|
|||
Function |
May play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Chemotactic for monocytes, dendritic cells and natural killer cells. Mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemoattractant activity for neutrophils, eosinophils, and resting T-lymphocytes. Binds to CCR4. Processed forms MDC(3-69), MDC(5-69) and MDC(7-69) seem not be active.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Anti-PD-1 antibody Drug Info | |
Structure | + |
References | ||||
---|---|---|---|---|
Reference 1 | Synergistic efficacy of curcumin and anti-programmed cell death-1 in hepatocellular carcinoma. Life Sci. 2021 Mar 19;279:119359. |