Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
High mobility group HMGI-C (HMGA2)
|
|||
Synonyms |
High mobility group protein HMGI-C; High mobility group AThook protein 2; High mobility group AT-hook protein 2; HMGIC
|
|||
Gene Name |
HMGA2
|
|||
Gene ID | ||||
Sequence |
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSP
SKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED Click to Show/Hide
|
|||
Function |
Functions in cell cycle regulation through CCNA2. Plays an important role in chromosome condensation during the meiotic G2/M transition of spermatocytes. Plays a role in postnatal myogenesis, is involved in satellite cell activation. Functions as a transcriptional regulator.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Metformin NP Info | + | C1632 Drug Info | |
Structure | + |
References | ||||
---|---|---|---|---|
Reference 1 | In vitro and in vivo synergistic anti-tumor effect of LIN28 inhibitor and metformin in oral squamous cell carcinoma. Eur J Pharmacol. 2021 Jan 15;891:173757. |