Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
DNA damage-inducible transcript 1 (GADD45A)
|
|||
Synonyms |
DNA damage-inducible transcript 1 protein; DDIT-1; Growth arrest/DNA damage-inducible protein GADD45 alpha
|
|||
Gene Name |
GADD45A
|
|||
Gene ID | ||||
Sequence |
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER Click to Show/Hide
|
|||
Function |
In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity (By similarity). Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. {ECO:0000250}.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Elemene NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Luteolin NP Info | + | Lapatinib Drug Info | |
Structure | + |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | Cucurbitacin E | NP Info | Investigative | Cucumic melo |