Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Bcl2 antagonist of cell death (BAD)
|
|||
Synonyms |
BAD; Bcl-2-binding component 6; Bcl-2-like protein 8; Bcl2-L-8; Bcl-xL/Bcl-2-associated death promoter; Bcl2 antagonist of cell death; Bcl2-associated agonist of cell death
|
|||
Gene Name |
BAD
|
|||
Gene ID | ||||
Sequence |
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ Click to Show/Hide
|
|||
Function |
Promotes cell death. Successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. Can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2 (By similarity). Appears to act as a link between growth factor receptor signaling and the apoptotic pathways. {ECO:0000250}.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Anisodamine NP Info | + | Neostigmine Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Quercetin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Expression of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Vasostatin Drug Info | |
Structure | + | |||
Drug Combination 3 Up-regulating the Expression of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Carnosic acid NP Info | + | Tamoxifen Drug Info | |
Structure | + | |||
Drug Combination 4 Up-regulating the Expression of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Mitomycin C Drug Info | |
Structure | + | |||
Drug Combination 5 Up-regulating the Expression of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 6 Up-regulating the Expression of This Molecule | [8] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gossypol NP Info | + | Zoledronic Drug Info | |
Structure | + | |||
Drug Combination 7 Up-regulating the Expression of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Daunorubicin NP Info | + | NL-101 Drug Info | |
Structure | + | |||
Drug Combination 8 Up-regulating the Expression of This Molecule | [10] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Elemene NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 9 Up-regulating the Expression of This Molecule | [11] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Apigenin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 10 Up-regulating the Expression of This Molecule | [12] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Bufalin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 11 Up-regulating the Expression of This Molecule | [13] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Betulinic Acid NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 12 Up-regulating the Expression of This Molecule | [14] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Luteolin NP Info | + | Celecoxib Drug Info | |
Structure | + |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | Cucurbitacin I | NP Info | Investigative | Citrullus lanatus |