Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
MAD2-like protein 1 (MAD2L1)
|
|||
Synonyms |
HsMAD2; Mitotic spindle assembly checkpoint protein MAD2A; Mitotic arrest deficient 2-like protein 1
|
|||
Gene Name |
MAD2L1
|
|||
Gene ID | ||||
Sequence |
MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLE
LIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKS QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE VRLRSFTTTIHKVNSMVAYKIPVND Click to Show/Hide
|
|||
Function |
Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. In the closed conformation (C-MAD2) forms a heterotetrameric complex with MAD1L1 at unattached kinetochores during prometaphase, the complex recruits open conformation molecules of MAD2L1 (O-MAD2) and then promotes the conversion of O-MAD2 to C-MAD2. Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Flavopiridol NP Info | + | Vorinostat Drug Info | |
Structure | + |
References | ||||
---|---|---|---|---|
Reference 1 | Combination of vorinostat and flavopiridol is selectively cytotoxic to multidrug-resistant neuroblastoma cell lines with mutant TP53. Mol Cancer Ther. 2010 Dec;9(12):3289-301. |