Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
PMA-induced protein 1 (PMAIP1)
|
|||
Synonyms |
Phorbol-12-myristate-13-acetate-induced protein 1; Immediate-early-response protein APR; Protein Noxa
|
|||
Gene Name |
PMAIP1
|
|||
Gene ID | ||||
Sequence |
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
Click to Show/Hide
|
|||
Function |
Promotes activation of caspases and apoptosis. Promotes mitochondrial membrane changes and efflux of apoptogenic proteins from the mitochondria. Contributes to p53/TP53-dependent apoptosis after radiation exposure. Promotes proteasomal degradation of MCL1. Competes with BAK1 for binding to MCL1 and can displace BAK1 from its binding site on MCL1 (By similarity). Competes with BIM/BCL2L11 for binding to MCL1 and can displace BIM/BCL2L11 from its binding site on MCL1.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Venetoclax Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 3 Up-regulating the Expression of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Celastrol NP Info | + | ABT-737 Drug Info | |
Structure | + | |||
Drug Combination 4 Up-regulating the Expression of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gossypol NP Info | + | Gemcitabine Drug Info | |
Structure | + |