Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Proto-oncogene c-Myc (MYC)
|
|||
Synonyms |
Transcription factor p64; Myc proto-oncogene protein; Class E basic helix-loop-helix protein 39; BHLHE39
|
|||
Gene Name |
MYC
|
|||
Gene ID | ||||
Sequence |
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL RKRREQLKHKLEQLRNSCA Click to Show/Hide
|
|||
Function |
Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3'. Activates the transcription of growth-related genes. Binds to the VEGFA promoter, promoting VEGFA production and subsequent sprouting angiogenesis. Regulator of somatic reprogramming, controls self-renewal of embryonic stem cells. Functions with TAF6L to activate target gene expression through RNA polymerase II pause release (By similarity).
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | AMD3100 Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Apigenin NP Info | + | Gefitinib Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ursolic acid NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Capecitabine Drug Info | |
Structure | + | |||
Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Cardamonin NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Betulinic Acid NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 9 Down-regulating the Expression of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 10 Down-regulating the Expression of This Molecule | [10] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Kaempferol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 11 Down-regulating the Expression of This Molecule | [11] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 12 Down-regulating the Expression of This Molecule | [12] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Shikonin NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 13 Down-regulating the Expression of This Molecule | [13] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Eugenol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 14 Down-regulating the Expression of This Molecule | [14] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Esculetin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 15 Down-regulating the Expression of This Molecule | [15] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Artemisinin NP Info | + | Oxaliplatin Drug Info | |
Structure | + | |||
Drug Combination 16 Down-regulating the Expression of This Molecule | [16] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Shikonin NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 17 Down-regulating the Expression of This Molecule | [17] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Tamoxifen Drug Info | |
Structure | + | |||
Drug Combination 18 Down-regulating the Expression of This Molecule | [18] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Piperine NP Info | + | Celecoxib Drug Info | |
Structure | + | |||
Drug Combination 19 Down-regulating the Expression of This Molecule | [19] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Cardamonin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 20 Down-regulating the Expression of This Molecule | [20] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | BIBR1532 Drug Info | |
Structure | + | |||
Drug Combination 21 Down-regulating the Expression of This Molecule | [21] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Fisetin NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 22 Down-regulating the Expression of This Molecule | [22] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Biochanin A NP Info | + | Temozolomide Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [23] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Elemene NP Info | + | Gefitinib Drug Info | |
Structure | + |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | Wogonoside | NP Info | Investigative | Scutellaria baicalensis |
Drug(s) of This Target | ||||
---|---|---|---|---|
1 | Deoxynivalenol | Drug Info | Investigative | Lung cancer |