Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Cadherin-1 (CDH1)
|
|||
Synonyms |
Epithelial cadherin; Uvomorulin; UVO; E-cadherin gene; E-cadherin; Cadherin-1; CDHE; CD324; CAM 120/80
|
|||
Gene Name |
CDH1
|
|||
Gene ID | ||||
Sequence |
MGPWSRSLSALLLLLQVSSWLCQEPEPCHPGFDAESYTFTVPRRHLERGRVLGRVNFEDC
TGRQRTAYFSLDTRFKVGTDGVITVKRPLRFHNPQIHFLVYAWDSTYRKFSTKVTLNTVG HHHRPPPHQASVSGIQAELLTFPNSSPGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS NKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGN AVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAI AYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTAT AVITVTDTNDNPPIFNPTTYKGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDG GQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV NEAPIFVPPEKRVEVSEDFGVGQEITSYTAQEPDTFMEQKITYRIWRDTANWLEINPDTG AISTRAELDREDFEHVKNSTYTALIIATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTI FFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEV GDYKINLKLMDNQNKDQVTTLEVSVCDCEGAAGVCRKAQPVEAGLQIPAILGILGGILAL LILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARP EVTRNDVAPTLMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGS EAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD Click to Show/Hide
|
|||
Function |
Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. CDH1 is involved in mechanisms regulating cell-cell adhesions, mobility and proliferation of epithelial cells. Has a potent invasive suppressor role. It is a ligand for integrin alpha-E/beta-7.; E-Cad/CTF2 promotes non-amyloidogenic degradation of Abeta precursors. Has a strong inhibitory effect on APP C99 and C83 production; (Microbial infection) Serves as a receptor for Listeria monocytogenes; internalin A (InlA) binds to this protein and promotes uptake of the bacteria.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ginsenoside compound K NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Elemene NP Info | + | Cetuximab Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Tetrandrine NP Info | + | Cisplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [4] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Resveratrol NP Info | + | 5-fluorouracil Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Up-regulating the Expression of This Molecule | [5] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Up-regulating the Expression of This Molecule | [6] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Ellagic acid NP Info | + | Temozolomide Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 4 Up-regulating the Expression of This Molecule | [7] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Schisandrol B NP Info | + | Doxorubicin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 5 Up-regulating the Expression of This Molecule | [8] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Fisetin NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 6 Up-regulating the Expression of This Molecule | [9] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Elemene NP Info | + | Gefitinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 7 Up-regulating the Expression of This Molecule | [10] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Vitamin K NP Info | + | Sorafenib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 8 Up-regulating the Expression of This Molecule | [11] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Neferine NP Info | + | Oxaliplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 9 Up-regulating the Expression of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Elemene NP Info | + | Cetuximab Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 10 Up-regulating the Expression of This Molecule | [12] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Celastrol NP Info | + | Vorinostat Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 11 Up-regulating the Expression of This Molecule | [13] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Bufalin NP Info | + | Afatinib Drug Info | |
Structure |
![]() |
+ |
![]() |