Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Apoptosis regulator BAK (BAK)
|
|||
Synonyms |
CDN1; Bcl2like protein 7; Bcl2L7; Bcl2-L-7; Bcl2 homologous antagonist/killer; Bcl-2-like protein 7; Bcl-2 homologous antagonist/killer
|
|||
Gene Name |
BAK1
|
|||
Gene ID | ||||
Sequence |
MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS Click to Show/Hide
|
|||
Function |
Plays a role in the mitochondrial apoptosic process. Upon arrival of cell death signals, promotes mitochondrial outer membrane (MOM) permeabilization by oligomerizing to form pores within the MOM. This releases apoptogenic factors into the cytosol, including cytochrome c, promoting the activation of caspase 9 which in turn processes and activates the effector caspases.
Click to Show/Hide
|
|||
Uniprot ID | ||||
TC Number | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Vasostatin Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Carnosic acid NP Info | + | Tamoxifen Drug Info | |
Structure | + | |||
Drug Combination 3 Up-regulating the Expression of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Fisetin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 4 Up-regulating the Expression of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Fisetin NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 5 Up-regulating the Expression of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Mitomycin C Drug Info | |
Structure | + | |||
Drug Combination 6 Up-regulating the Expression of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Paclitaxel NP Info | + | ABT-737 Drug Info | |
Structure | + | |||
Drug Combination 7 Up-regulating the Expression of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Amentoflavone NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 8 Up-regulating the Expression of This Molecule | [8] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Piceatannol NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 9 Up-regulating the Expression of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 10 Up-regulating the Expression of This Molecule | [10] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 11 Up-regulating the Expression of This Molecule | [11] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Betulinic Acid NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 12 Up-regulating the Expression of This Molecule | [12] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gambogic acid NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 13 Up-regulating the Expression of This Molecule | [13] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Luteolin NP Info | + | Celecoxib Drug Info | |
Structure | + | |||
Drug Combination 14 Up-regulating the Expression of This Molecule | [14] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Capsaicin NP Info | + | 3,3'-diindolylmethane Drug Info | |
Structure | + |