Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
STAT factor 3 (STAT3)
|
|||
Synonyms |
Signal transducer and activator of transcription 3; Acute-phase response factor; APRF
|
|||
Gene Name |
STAT3
|
|||
Gene ID | ||||
Sequence |
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM Click to Show/Hide
|
|||
Function |
Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors. Once activated, recruits coactivators, such as NCOA1 or MED1, to the promoter region of the target gene. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Upon activation of IL6ST/gp130 signaling by interleukin-6 (IL6), binds to the IL6-responsive elements identified in the promoters of various acute-phase protein genes. Activated by IL31 through IL31RA. Acts as a regulator of inflammatory response by regulating differentiation of naive CD4(+) T-cells into T-helper Th17 or regulatory T-cells (Treg): deacetylation and oxidation of lysine residues by LOXL3, leads to disrupt STAT3 dimerization and inhibit its transcription activity. Involved in cell cycle regulation by inducing the expression of key genes for the progression from G1 to S phase, such as CCND1. Mediates the effects of LEP on melanocortin production, body energy homeostasis and lactation (By similarity). May play an apoptotic role by transctivating BIRC5 expression under LEP activation. Cytoplasmic STAT3 represses macroautophagy by inhibiting EIF2AK2/PKR activity. Plays a crucial role in basal beta cell functions, such as regulation of insulin secretion (By similarity).
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Plumbagin NP Info | + | Celecoxib Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | AMD3100 Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Shikonin NP Info | + | Gefitinib Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ursolic acid NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Cardamonin NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Thalidomide Drug Info | |
Structure | + | |||
Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Cardamonin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [32] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arctigenin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Expression of This Molecule | [33] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Anisodamine NP Info | + | Neostigmine Drug Info | |
Structure | + | |||
Drug Combination 3 Up-regulating the Expression of This Molecule | [34] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arctigenin NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Phosphorylation Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Phosphorylation of This Molecule | [8] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Silibinin NP Info | + | Indole-3-carbinol Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Phosphorylation of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Phosphorylation of This Molecule | [10] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Bortezomib Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Phosphorylation of This Molecule | [11] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Shikonin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 5 Down-regulating the Phosphorylation of This Molecule | [12] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ursodeoxycholic acid NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 6 Down-regulating the Phosphorylation of This Molecule | [13] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Schisandrin A NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 7 Down-regulating the Phosphorylation of This Molecule | [14] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Morin NP Info | + | MST312 Drug Info | |
Structure | + | |||
Drug Combination 8 Down-regulating the Phosphorylation of This Molecule | [15] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Celastrol NP Info | + | Erlotinib Drug Info | |
Structure | + | |||
Drug Combination 9 Down-regulating the Phosphorylation of This Molecule | [16] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Tanshinone IIA NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 10 Down-regulating the Phosphorylation of This Molecule | [17] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 11 Down-regulating the Phosphorylation of This Molecule | [15] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Celastrol NP Info | + | Gefitinib Drug Info | |
Structure | + | |||
Drug Combination 12 Down-regulating the Phosphorylation of This Molecule | [18] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gallic acid NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 13 Down-regulating the Phosphorylation of This Molecule | [19] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Piperine NP Info | + | Mitomycin C Drug Info | |
Structure | + | |||
Drug Combination 14 Down-regulating the Phosphorylation of This Molecule | [20] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Toosendanin NP Info | + | Regorafenib Drug Info | |
Structure | + | |||
Drug Combination 15 Down-regulating the Phosphorylation of This Molecule | [21] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Elemene NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 16 Down-regulating the Phosphorylation of This Molecule | [22] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Paclitaxel NP Info | + | Napabucasin Drug Info | |
Structure | + | |||
Drug Combination 17 Down-regulating the Phosphorylation of This Molecule | [23] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Apigenin NP Info | + | Cetuximab Drug Info | |
Structure | + | |||
Drug Combination 18 Down-regulating the Phosphorylation of This Molecule | [24] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 19 Down-regulating the Phosphorylation of This Molecule | [25] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Flavopiridol NP Info | + | Bortezomib Drug Info | |
Structure | + | |||
Drug Combination 20 Down-regulating the Phosphorylation of This Molecule | [26] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ursolic acid NP Info | + | Capecitabine Drug Info | |
Structure | + | |||
Drug Combination 21 Down-regulating the Phosphorylation of This Molecule | [27] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Silibinin NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 22 Down-regulating the Phosphorylation of This Molecule | [28] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Galangin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 23 Down-regulating the Phosphorylation of This Molecule | [29] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Temozolomide Drug Info | |
Structure | + | |||
Drug Combination 24 Down-regulating the Phosphorylation of This Molecule | [30] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Pterostilbene NP Info | + | Osimertinib Drug Info | |
Structure | + | |||
Drug Combination 25 Down-regulating the Phosphorylation of This Molecule | [31] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Capsaicin NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Phosphorylation of This Molecule | [35] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Lycopene NP Info | + | Anti-PD-1 antibody Drug Info | |
Structure | + |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | Acitretin | NP Info | Approved | Homo sapiens |
2 | Cryptotanshinone | NP Info | Investigative | Salvia miltiorrhiza |
3 | Cucurbitacin I | NP Info | Investigative | Citrullus lanatus |
4 | Osthole | NP Info | Investigative | Angelica pubescens |
5 | Toosendanin | NP Info | Investigative | Melia azedarach |
Drug(s) of This Target | ||||
---|---|---|---|---|
1 | Dicyclohexylcarbodiimide | Drug Info | Investigative | Prostate cancer |
2 | Napabucasin | Drug Info | Phase 3 | Pancreatic cancer |
3 | S3I-201 | Drug Info | Investigative | Lupus nephritis |