Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Interleukin-1 beta (IL1B)
|
|||
Synonyms |
IL1F2; IL-1beta; IL-1 beta; Catabolin
|
|||
Gene Name |
IL1B
|
|||
Gene ID | ||||
Sequence |
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST SQAENMPVFLGGTKGGQDITDFTMQFVSS Click to Show/Hide
|
|||
Function |
Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Potent proinflammatory cytokine.
Click to Show/Hide
|
|||
Uniprot ID | ||||
TC Number | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Pterostilbene NP Info | + | Vorinostat Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Polydatin NP Info | + | N-palmitoylethanolamine Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gentiopicroside | + | Leflunomide + Methotrexate | |
Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
Gentiopicroside NP Info | Drug Info | |||
Drug Info | ||||
Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Eugenol NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Acteoside NP Info | + | Thymic stromal lymphopoietin Drug Info | |
Structure | + | |||
Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Vitamin D NP Info | + | Spironolactone Drug Info | |
Structure | + | |||
Drug Combination 9 Down-regulating the Expression of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Semaglutide NP Info | + | Rosiglitazone Drug Info | |
Structure | + | |||
Drug Combination 10 Down-regulating the Expression of This Molecule | [10] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | Fernblock Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [12] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Metformin NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Expression of This Molecule | [13] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Recombinant vaccinia Neu vaccine Drug Info | |
Structure | + | |||
Secretion Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Secretion of This Molecule | [11] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Aloin NP Info | + | Doxorubicin Drug Info | |
Structure | + |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | Cardamonin | NP Info | Investigative | Alpinia zerumbet |
2 | Celastrol | NP Info | Preclinical | Celastrus strigillosus |
3 | Glucosamine | NP Info | Approved | Homo sapiens |
4 | Magnolol | NP Info | Investigative | Magnolia officinalis |