Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Apoptosis regulator Bcl-xL (BCL-xL)
|
|||
Synonyms |
Bcl2like protein 1; Bcl2L1; Bcl2-L-1; Bcl-XL; Bcl-2-like protein 1; BCLX; BCL2L; Apoptosis regulator Bcl-X
|
|||
Gene Name |
BCL2L1
|
|||
Gene ID | ||||
Sequence |
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK Click to Show/Hide
|
|||
Function |
Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis. Potent inhibitor of cell death.
Click to Show/Hide
|
|||
Uniprot ID | ||||
TC Number | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Pterostilbene NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Vasostatin Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Carnosic acid NP Info | + | Tamoxifen Drug Info | |
Structure | + | |||
Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Shikonin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gambogic acid NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 9 Down-regulating the Expression of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Dasatinib Drug Info | |
Structure | + | |||
Drug Combination 10 Down-regulating the Expression of This Molecule | [10] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Thymoquinone NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 11 Down-regulating the Expression of This Molecule | [11] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gossypol NP Info | + | Imatinib Drug Info | |
Structure | + | |||
Drug Combination 12 Down-regulating the Expression of This Molecule | [12] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Betulinic Acid NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 13 Down-regulating the Expression of This Molecule | [13] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Elemene NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 14 Down-regulating the Expression of This Molecule | [14] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Thalidomide Drug Info | |
Structure | + | |||
Drug Combination 15 Down-regulating the Expression of This Molecule | [15] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 16 Down-regulating the Expression of This Molecule | [16] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 17 Down-regulating the Expression of This Molecule | [17] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | ABT-737 Drug Info | |
Structure | + | |||
Drug Combination 18 Down-regulating the Expression of This Molecule | [18] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Flavopiridol NP Info | + | Bortezomib Drug Info | |
Structure | + | |||
Drug Combination 19 Down-regulating the Expression of This Molecule | [19] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Apigenin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 20 Down-regulating the Expression of This Molecule | [20] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 21 Down-regulating the Expression of This Molecule | [21] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Shikonin NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 22 Down-regulating the Expression of This Molecule | [22] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 23 Down-regulating the Expression of This Molecule | [23] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ursolic acid NP Info | + | Capecitabine Drug Info | |
Structure | + | |||
Drug Combination 24 Down-regulating the Expression of This Molecule | [24] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Bufalin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 25 Down-regulating the Expression of This Molecule | [25] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Silibinin NP Info | + | Vorinostat Drug Info | |
Structure | + | |||
Drug Combination 26 Down-regulating the Expression of This Molecule | [26] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 27 Down-regulating the Expression of This Molecule | [27] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gossypol NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 28 Down-regulating the Expression of This Molecule | [28] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | Terazosin Drug Info | |
Structure | + | |||
Drug Combination 29 Down-regulating the Expression of This Molecule | [29] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Chlorogenic acid NP Info | + | Regorafenib Drug Info | |
Structure | + | |||
Drug Combination 30 Down-regulating the Expression of This Molecule | [30] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 31 Down-regulating the Expression of This Molecule | [31] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Tamoxifen Drug Info | |
Structure | + | |||
Drug Combination 32 Down-regulating the Expression of This Molecule | [32] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 33 Down-regulating the Expression of This Molecule | [33] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Vincristine NP Info | + | Vorinostat Drug Info | |
Structure | + | |||
Drug Combination 34 Down-regulating the Expression of This Molecule | [34] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | BIBR1532 Drug Info | |
Structure | + | |||
Drug Combination 35 Down-regulating the Expression of This Molecule | [35] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Furanodiene + Curdione | + | Germacrone | |
Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
Furanodiene NP Info | Drug Info | |||
Curdione NP Info | ||||
Drug Combination 36 Down-regulating the Expression of This Molecule | [25] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Silibinin NP Info | + | Trichostatin A Drug Info | |
Structure | + | |||
Drug Combination 37 Down-regulating the Expression of This Molecule | [36] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gambogic acid NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 38 Down-regulating the Expression of This Molecule | [37] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Luteolin NP Info | + | SMC3 Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [38] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Expression of This Molecule | [26] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 3 Up-regulating the Expression of This Molecule | [39] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Lonidamine Drug Info | |
Structure | + |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | Cucurbitacin D | NP Info | Investigative | Cucurbitaceae |
2 | Cucurbitacin I | NP Info | Investigative | Citrullus lanatus |
Drug(s) of This Target | ||||
---|---|---|---|---|
1 | ABT-263 | Drug Info | Phase 2 | Chronic lymphocytic leukaemia |