Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Interleukin-8 (IL8)
|
|||
| Synonyms |
T-cell chemotactic factor; Protein 3-10C; Neutrophil-activating protein 1; NAP-1; Monocyte-derived neutrophil-activating peptide; Monocyte-derived neutrophil chemotactic factor; MONAP; MDNCF; IL8; IL-8; Granulocyte chemotactic protein 1; GCP-1; Emoctakin; Chemokine (C-X-C motif) ligand 8; C-X-C motif chemokine 8
|
|||
| Gene Name |
CXCL8
|
|||
| Gene ID | ||||
| Sequence |
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Click to Show/Hide
|
|||
| Function |
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| TTD ID | ||||
| Drug(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Ibuprofen | Drug Info | Approved | Pain |
| References | ||||
|---|---|---|---|---|
| Reference 1 | Structure-Activity Relationship of novel phenylacetic CXCR1 inhibitors. Bioorg Med Chem Lett. 2009 Aug 1;19(15):4026-30. | |||