Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Interleukin-12 alpha (IL12A)
|
|||
| Synonyms |
NKSF1; NKSF; NK cell stimulatory factor chain 1; NK cell stimulatory factor; Interleukin-12 subunit alpha; IL-12A; IL-12 subunit p35; IL-12; Cytotoxic lymphocyte maturation factor 35 kDa subunit; CLMF p35
|
|||
| Gene Name |
IL12A
|
|||
| Gene ID | ||||
| Sequence |
MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLE
FYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMM ALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQK SSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS Click to Show/Hide
|
|||
| Function |
Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Glatiramer acetate NP Info | + | Atorvastatin Drug Info | |
| Structure |
|
+ |
|
|
| References | ||||
|---|---|---|---|---|
| Reference 1 | Immunomodulatory synergy by combination of atorvastatin and glatiramer acetate in treatment of CNS autoimmunity. J Clin Invest. 2006 Apr;116(4):1037-44. | |||