Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Gamma-aminobutyric acid receptor gamma-1 (RAB5A)
|
|||
| Gene Name |
RAB5A
|
|||
| Gene ID | ||||
| Sequence |
MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ
TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN Click to Show/Hide
|
|||
| Function |
Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Active GTP-bound form is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes. Contributes to the regulation of filopodia extension. Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan. Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3 (By similarity).
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Saikosaponin D | NP Info | Investigative | Bupleurum scorzonerifolium |
| References | ||||
|---|---|---|---|---|
| Reference 1 | Saikosaponin D suppresses enterovirus A71 infection by inhibiting autophagy. Signal Transduct Target Ther. 2019 Feb 22;4:4. | |||