Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Duffy antigen chemokine receptor (ACKR1)
|
|||
| Synonyms |
Plasmodium vivax receptor; GpFy; Glycoprotein D; Fy glycoprotein; Duffy antigen/chemokine receptor; DARC; CD234; ACKR1
|
|||
| Gene Name |
ACKR1
|
|||
| Gene ID | ||||
| Sequence |
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDS
ALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGL GSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALL TLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPG PWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVAT PLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS Click to Show/Hide
|
|||
| Function |
Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Has a promiscuous chemokine-binding profile, interacting with inflammatory chemokines of both the CXC and the CC subfamilies but not with homeostatic chemokines. Acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, TARC and also for the malaria parasites P.vivax and P.knowlesi. May regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it sustains the abluminal to luminal transcytosis of tissue-derived chemokines and their subsequent presentation to circulating leukocytes; when expressed in erythrocytes, serves as blood reservoir of cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| TTD ID | ||||
| Drug(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Chloroquine | Drug Info | Approved | Malaria |
| References | ||||
|---|---|---|---|---|
| Reference 1 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. | |||