Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Hypoxia-inducible factor 1 alpha (HIF-1A)
|
|||
| Synonyms |
bHLHe78; Transcription factor HIF-1; PASD8; PAS domain-containing protein 8; Member of PAS protein 1; MOP1; Hypoxia-inducible transcription factor (HIF)-1; Hypoxia-inducible factor 1-alpha; Hypoxia-inducible factor 1 A; Hypoxia inducible factor 1; HIF1-alpha; HIF1 alpha; HIF-1alpha; HIF-1-alpha; HIF-1 alpha; Class E basic helix-loop-helix protein 78; Basic-helix-loop-
|
|||
| Gene Name |
HIF1A
|
|||
| Gene ID | ||||
| Sequence |
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR Click to Show/Hide
|
|||
| Function |
Under hypoxic conditions, activates the transcription of over 40 genes, including erythropoietin, glucose transporters, glycolytic enzymes, vascular endothelial growth factor, HILPDA, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. Plays an essential role in embryonic vascularization, tumor angiogenesis and p
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| KEGG ID | ||||
| TTD ID | ||||
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Chuanxiong Rhizoma | NP Info | . | Not Available |
| Drug(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Temozolomide | Drug Info | Approved | Brain cancer |