Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Nuclear nucleic acid-binding C1D (C1D)
|
|||
| Synonyms |
Nuclear nucleic acid-binding protein C1D; hC1D
|
|||
| Gene Name |
C1D
|
|||
| Gene ID | ||||
| Sequence |
MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSA
YTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKN ALWEPKSKNASKVANKGKSKS Click to Show/Hide
|
|||
| Function |
Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB (By similarity).
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Pentagalloylglucose NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| References | ||||
|---|---|---|---|---|
| Reference 1 | Inhibitory effects and molecular mechanisms of pentagalloyl glucose in combination with 5-FU on aggressive phenotypes of HepG2 cells. Nat Prod Res. 2021 Mar;35(5):815-818. | |||