Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
AT1 receptor-associated protein (AGTRAP)
|
|||
| Synonyms |
Type-1 angiotensin II receptor-associated protein
|
|||
| Gene Name |
AGTRAP
|
|||
| Gene ID | ||||
| Sequence |
MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGG
LLATIFLDIVHISIFYPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGELLVH TGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGY Click to Show/Hide
|
|||
| Function |
Appears to be a negative regulator of type-1 angiotensin II receptor-mediated signaling by regulating receptor internalisation as well as mechanism of receptor desensitization such as phosphorylation. Induces also a decrease in cell proliferation and angiotensin II-stimulated transcriptional activity.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Mycophenolate mofetil NP Info | + | Losartan Drug Info | |
| Structure |
|
+ |
|
|
| References | ||||
|---|---|---|---|---|
| Reference 1 | Synergistic effects of mycophenolate mofetil and losartan in a model of chronic cyclosporine nephropathy. Transplantation. 2003 Feb 15;75(3):309-15. | |||