Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Immediate-early gene IEX-1 (IER3)
|
|||
| Synonyms |
Differentiation-dependent gene 2 protein; Protein DIF-2; Immediate early protein GLY96; Immediate early response 3 protein; PACAP-responsive gene 1 protein; Protein PRG1; Radiation-inducible immediate-early gene IEX-1
|
|||
| Gene Name |
IER3
|
|||
| Gene ID | ||||
| Sequence |
MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRK
RSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASL APTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF Click to Show/Hide
|
|||
| Function |
May play a role in the ERK signaling pathway by inhibiting the dephosphorylation of ERK by phosphatase PP2A-PPP2R5C holoenzyme. Acts also as an ERK downstream effector mediating survival. As a member of the NUPR1/RELB/IER3 survival pathway, may provide pancreatic ductal adenocarcinoma with remarkable resistance to cell stress, such as starvation or gemcitabine treatment.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| KEGG ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Bacillus Calmette-Guerin Drug Info | |
| Structure |
|
+ |
|
|