Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Potassium channel K4 TRAAK (KCNK4)
|
|||
| Synonyms |
TWIK-related arachidonic acid-stimulated potassium channel protein; TRAAK; Two pore potassium channel KT4.1; Two pore K(+) channel KT4.1; Potassium channel subfamily K member 4
|
|||
| Gene Name |
KCNK4
|
|||
| Gene ID | ||||
| Sequence |
MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAHPCVSDQELGL
LIKEVADALGGGADPETNSTSNSSHSAWDLGSAFFFSGTIITTIGYGNVALRTDAGRLFC IFYALVGIPLFGILLAGVGDRLGSSLRHGIGHIEAIFLKWHVPPELVRVLSAMLFLLIGC LLFVLTPTFVFCYMEDWSKLEAIYFVIVTLTTVGFGDYVAGADPRQDSPAYQPLVWFWIL LGLAYFASVLTTIGNWLRVVSRRTRAEMGGLTAQAASWTGTVTARVTQRAGPAAPPPEKE QPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCP LPRAPRGRRRPNPPRKPVRPRGPGRPRDKGVPV Click to Show/Hide
|
|||
| Function |
Voltage-insensitive potassium channel. Channel opening is triggered by mechanical forces that deform the membrane. Channel opening is triggered by raising the intracellular pH to basic levels. The channel is inactive at 24 degrees Celsius (in vitro); raising the temperature to 37 degrees Celsius increases the frequency of channel opening, with a further increase in channel activity when the temperature is raised to 42 degrees Celsius. Plays a role in the perception of pain caused by heat. Plays a role in the sensory perception of pain caused by pressure.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| VARIDT ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Alpha linolenic acid NP Info | + | Riluzole Drug Info | |
| Structure |
|
+ |
|
|
| References | ||||
|---|---|---|---|---|
| Reference 1 | Alpha-linolenic acid and riluzole treatment confer cerebral protection and improve survival after focal brain ischemia. Neuroscience. 2006;137(1):241-51. | |||