Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
CDK inhibitor 4C p18-INK4c (CDKN2C)
|
|||
| Synonyms |
P18-INK6; P18-INK4c; P18(INK4c) protein; P18(INK4c); P18 INK4c protein; Cyclin-dependent kinase 6 inhibitor; Cyclin-dependent kinase 4 inhibitor C
|
|||
| Gene Name |
CDKN2C
|
|||
| Gene ID | ||||
| Sequence |
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVE FLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ Click to Show/Hide
|
|||
| Function |
Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Capsaicin NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| References | ||||
|---|---|---|---|---|
| Reference 1 | Capsaicin induces apoptosis of cisplatin-resistant stomach cancer cells by causing degradation of cisplatin-inducible Aurora-A protein. Nutr Cancer. 2011;63(7):1095-103. | |||