Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Chromobox homolog 3 (CBX3)
|
|||
| Synonyms |
Chromobox protein homolog 3; HECH; Heterochromatin protein 1 homolog gamma; HP1 gamma; Modifier 2 protein
|
|||
| Gene Name |
CBX3
|
|||
| Gene ID | ||||
| Sequence |
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNT
WEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARG LDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPED EAQ Click to Show/Hide
|
|||
| Function |
Seems to be involved in transcriptional silencing in heterochromatin-like complexes. Recognizes and binds histone H3 tails methylated at 'Lys-9', leading to epigenetic repression. May contribute to the association of the heterochromatin with the inner nuclear membrane through its interaction with lamin B receptor (LBR). Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins. Contributes to the conversion of local chromatin to a heterochromatin-like repressive state through H3 'Lys-9' trimethylation, mediates the recruitment of the methyltransferases SUV39H1 and/or SUV39H2 by the PER complex to the E-box elements of the circadian target genes such as PER2 itself or PER1. Mediates the recruitment of NIPBL to sites of DNA damage at double-strand breaks (DSBs).
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Arsenic trioxide NP Info | + | Recombinant mutant human TRAIL Drug Info | |
| Structure |
|
+ |
|
|
| References | ||||
|---|---|---|---|---|
| Reference 1 | Effects and mechanism of arsenic trioxide in combination with rmhTRAIL in multiple myeloma. Exp Hematol. 2016 Feb;44(2):125-131.e11. | |||