Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Heat shock protein 20 (HSP20)
|
|||
| Synonyms |
Stress-responsive protein 27; SRP27; HspB1; Heat shock protein beta-1; Heat shock 27 kDa protein; HSP28; HSP27; HSP 27; Estrogen-regulated 24 kDa protein; 28 kDa heat shock protein
|
|||
| Gene Name |
HSPB1
|
|||
| Gene ID | ||||
| Sequence |
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT IPVTFESRAQLGGPEAAKSDETAAK Click to Show/Hide
|
|||
| Function |
Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Plays a role in stress resistance and actin organization. Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Gossypol NP Info | + | Zoledronic Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|