Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
C-X-C motif chemokine 1 (CXCL1)
|
|||
| Synonyms |
SCYB1; Neutrophil-activating protein 3; NAP-3; Melanoma growth stimulatory activity; MGSA; Growth-regulated alpha protein; Growth regulated protein; GROA; GRO1; GRO-alpha(1-73); GRO-alpha; GRO-a protein; GRO
|
|||
| Gene Name |
CXCL1
|
|||
| Gene ID | ||||
| Sequence |
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN Click to Show/Hide
|
|||
| Function |
May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO-alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. Has chemotactic activity for neutrophils.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Baohuoside I | NP Info | . | Not Available |
| 2 | Paclitaxel | NP Info | Approved | Taxus brevifolia |
| 3 | Xanthohumol | NP Info | Investigative | Humulus lupulus |