Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
HES-related repressor 1 (HEY1)
|
|||
| Synonyms |
HES-related repressor protein 1; Cardiovascular helix-loop-helix factor 2; CHF-2; Class B basic helix-loop-helix protein 31; bHLHb31; Hairy and enhancer of split-related protein 1; HESR-1; Hairy-related transcription factor 1; HRT-1; Hhrt1; Hairy/enhancer-of-split related with YRPW motif protein 1
|
|||
| Gene Name |
HEY1
|
|||
| Gene ID | ||||
| Sequence |
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPW GTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV LPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE IGAF Click to Show/Hide
|
|||
| Function |
Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3'. Downstream effector of Notch signaling required for cardiovascular development. Specifically required for the Notch-induced endocardial epithelial to mesenchymal transition, which is itself criticial for cardiac valve and septum development. May be required in conjunction with HEY2 to specify arterial cell fate or identity. Promotes maintenance of neuronal precursor cells and glial versus neuronal fate specification. Represses transcription by the cardiac transcriptional activators GATA4 and GATA6 and by the neuronal bHLH factors ASCL1/MASH1 and NEUROD4/MATH3. Involved in the regulation of liver cancer cells self-renewal.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| TC Number | ||||
| Pfam | ||||
| KEGG ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Eugenol NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|