Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Glycoprotein hormones alpha (CGA)
|
|||
| Synonyms |
Thyrotropin alpha chain; Thyroid-stimulating hormone alpha chain; TSH-alpha; Lutropin alpha chain; Luteinizing hormone alpha chain; LSH-alpha; Glycoprotein hormones alpha chain; Follitropin alpha chain; Follicle-stimulating hormone alpha chain; FSH-alpha; Chorionic gonadotrophin subunit alpha; Choriogonadotropin alpha chain; CG-alpha; Anterior pituitary glycoprotein hormones common subunit alpha
|
|||
| Gene Name |
CGA
|
|||
| Gene ID | ||||
| Sequence |
MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRA
YPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS Click to Show/Hide
|
|||
| Function |
Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH, follitropin/follicle stimulating hormone/FSH and choriogonadotropin/CG. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Sulforaphane NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|