Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
S100 calcium-binding protein B (S100B)
|
|||
| Synonyms |
S-100 protein subunit beta; S-100 protein beta chain; Protein S100-B
|
|||
| Gene Name |
S100B
|
|||
| Gene ID | ||||
| Sequence |
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Click to Show/Hide
|
|||
| Function |
Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity. Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| TC Number | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Cryptotanshinone | NP Info | Investigative | Salvia miltiorrhiza |
| References | ||||
|---|---|---|---|---|
| Reference 1 | Cryptotanshinone inhibits human glioma cell proliferation in vitro and in vivo through SHP-2-dependent inhibition of STAT3 activation. Cell Death Dis. 2017 May 11;8(5):e2767. | |||