Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
High mobility group HMGI-C (HMGA2)
|
|||
| Synonyms |
High mobility group protein HMGI-C; High mobility group AThook protein 2; High mobility group AT-hook protein 2; HMGIC
|
|||
| Gene Name |
HMGA2
|
|||
| Gene ID | ||||
| Sequence |
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSP
SKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED Click to Show/Hide
|
|||
| Function |
Functions in cell cycle regulation through CCNA2. Plays an important role in chromosome condensation during the meiotic G2/M transition of spermatocytes. Plays a role in postnatal myogenesis, is involved in satellite cell activation. Functions as a transcriptional regulator.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Metformin NP Info | + | C1632 Drug Info | |
| Structure |
|
+ |
|
|
| References | ||||
|---|---|---|---|---|
| Reference 1 | In vitro and in vivo synergistic anti-tumor effect of LIN28 inhibitor and metformin in oral squamous cell carcinoma. Eur J Pharmacol. 2021 Jan 15;891:173757. | |||