Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
DNA damage-inducible transcript 1 (GADD45A)
|
|||
| Synonyms |
DNA damage-inducible transcript 1 protein; DDIT-1; Growth arrest/DNA damage-inducible protein GADD45 alpha
|
|||
| Gene Name |
GADD45A
|
|||
| Gene ID | ||||
| Sequence |
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER Click to Show/Hide
|
|||
| Function |
In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity (By similarity). Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. {ECO:0000250}.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Elemene NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Up-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Luteolin NP Info | + | Lapatinib Drug Info | |
| Structure |
|
+ |
|
|
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Cucurbitacin E | NP Info | Investigative | Cucumic melo |