Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
ATP synthase F(0) complex C3 (ATP5MC3)
|
|||
| Synonyms |
ATP synthase lipid-binding protein; ATP synthase membrane subunit c locus 3; ATP synthase proteolipid P3; ATP synthase proton-transporting mitochondrial F(0) complex subunit C3; ATPase protein 9; ATPase subunit c
|
|||
| Gene Name |
ATP5MC3
|
|||
| Gene ID | ||||
| Sequence |
MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREF
QTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILG FALSEAMGLFCLMVAFLILFAM Click to Show/Hide
|
|||
| Function |
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. A homomeric c-ring of probably 10 subunits is part of the complex rotary element.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| Drug(s) of This Target | ||||
|---|---|---|---|---|
| 1 | S-1 | Drug Info | Phase 3 | Gastrointestinal stromal tumor |
| References | ||||
|---|---|---|---|---|
| Reference 1 | Single-molecule analysis of F0F1-ATP synthase inhibited by N,N-dicyclohexylcarbodiimide. J Biol Chem. 2013 Sep 6;288(36):25717-25726. | |||