Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Apoptosis regulator BAX (BAX)
|
|||
Synonyms |
Bcl-2-like protein 4; Bcl2-L-4
|
|||
Gene Name |
BAX
|
|||
Gene ID | ||||
Sequence |
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV LTASLTIWKKMG Click to Show/Hide
|
|||
Function |
Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
Click to Show/Hide
|
|||
Uniprot ID | ||||
TC Number | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Jerusalem artichoke + Interferon alpha-2a | + | Ribavirin | |
Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
Jerusalem artichoke NP Info | Drug Info | |||
Interferon alpha-2a NP Info | ||||
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Alpha linolenic acid NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Anisodamine NP Info | + | Neostigmine Drug Info | |
Structure | + | |||
Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Alpha linolenic acid NP Info | + | Gentamicin Drug Info | |
Structure | + | |||
Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Acteoside + Paeoniflorin | + | X-ray irradiation | |
Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
Acteoside NP Info | Drug Info | |||
Paeoniflorin NP Info | ||||
Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Alpha linolenic acid NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | 2-deoxy-D-glucose Drug Info | |
Structure | + | |||
Drug Combination 8 Down-regulating the Expression of This Molecule | [8] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Pentagalloylglucose NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 2 Up-regulating the Expression of This Molecule | [10] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Quercetin NP Info | + | Temozolomide Drug Info | |
Structure | + | |||
Drug Combination 3 Up-regulating the Expression of This Molecule | [11] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Osthole NP Info | + | Trastuzumab Drug Info | |
Structure | + | |||
Drug Combination 4 Up-regulating the Expression of This Molecule | [12] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Wogonin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 5 Up-regulating the Expression of This Molecule | [13] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Celastrol NP Info | + | Apatinib Drug Info | |
Structure | + | |||
Drug Combination 6 Up-regulating the Expression of This Molecule | [14] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Bufalin NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 7 Up-regulating the Expression of This Molecule | [15] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 8 Up-regulating the Expression of This Molecule | [16] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Pterostilbene NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 9 Up-regulating the Expression of This Molecule | [17] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Quercetin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 10 Up-regulating the Expression of This Molecule | [18] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Vasostatin Drug Info | |
Structure | + | |||
Drug Combination 11 Up-regulating the Expression of This Molecule | [19] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Elemene NP Info | + | Etoposide Drug Info | |
Structure | + | |||
Drug Combination 12 Up-regulating the Expression of This Molecule | [20] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 13 Up-regulating the Expression of This Molecule | [21] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Carnosic acid NP Info | + | Tamoxifen Drug Info | |
Structure | + | |||
Drug Combination 14 Up-regulating the Expression of This Molecule | [22] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Fisetin NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 15 Up-regulating the Expression of This Molecule | [23] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | 6-shogaol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 16 Up-regulating the Expression of This Molecule | [24] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Parthenolide NP Info | + | Epirubicin Drug Info | |
Structure | + | |||
Drug Combination 17 Up-regulating the Expression of This Molecule | [25] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Paeonol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 18 Up-regulating the Expression of This Molecule | [26] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Schisandrol B NP Info | + | Apatinib Drug Info | |
Structure | + | |||
Drug Combination 19 Up-regulating the Expression of This Molecule | [27] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Lycopene NP Info | + | Eicosapentaenoic acid Drug Info | |
Structure | + | |||
Drug Combination 20 Up-regulating the Expression of This Molecule | [28] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Lcotinib Drug Info | |
Structure | + | |||
Drug Combination 21 Up-regulating the Expression of This Molecule | [29] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Chlorogenic acid NP Info | + | Methotrexate Drug Info | |
Structure | + | |||
Drug Combination 22 Up-regulating the Expression of This Molecule | [30] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | ABT-737 Drug Info | |
Structure | + | |||
Drug Combination 23 Up-regulating the Expression of This Molecule | [31] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 24 Up-regulating the Expression of This Molecule | [32] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gambogic acid NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 25 Up-regulating the Expression of This Molecule | [33] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gambogic acid NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 26 Up-regulating the Expression of This Molecule | [34] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Shikonin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 27 Up-regulating the Expression of This Molecule | [35] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Mitomycin C Drug Info | |
Structure | + | |||
Drug Combination 28 Up-regulating the Expression of This Molecule | [36] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Allyl isothiocyanate NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 29 Up-regulating the Expression of This Molecule | [37] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Piperlongumine NP Info | + | Oxaliplatin Drug Info | |
Structure | + | |||
Drug Combination 30 Up-regulating the Expression of This Molecule | [38] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ceramide NP Info | + | N, N-dimethyl-D-erythro-sphingosine Drug Info | |
Drug Combination 31 Up-regulating the Expression of This Molecule | [39] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Apigenin NP Info | + | ABT-263 Drug Info | |
Structure | + | |||
Drug Combination 32 Up-regulating the Expression of This Molecule | [40] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Methylglyoxal NP Info | + | Glyoxalase I Drug Info | |
Structure | + | |||
Drug Combination 33 Up-regulating the Expression of This Molecule | [41] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Raloxifene Drug Info | |
Structure | + | |||
Drug Combination 34 Up-regulating the Expression of This Molecule | [42] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Bufalin NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 35 Up-regulating the Expression of This Molecule | [43] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 36 Up-regulating the Expression of This Molecule | [44] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Demethoxycurcumin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 37 Up-regulating the Expression of This Molecule | [45] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | 6-shogaol NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 38 Up-regulating the Expression of This Molecule | [46] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | HA14-1 Drug Info | |
Structure | + | |||
Drug Combination 39 Up-regulating the Expression of This Molecule | [47] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Tangeretin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 40 Up-regulating the Expression of This Molecule | [48] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Fisetin NP Info | + | Cabazitaxel Drug Info | |
Structure | + | |||
Drug Combination 41 Up-regulating the Expression of This Molecule | [49] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Tanshinone IIA NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 42 Up-regulating the Expression of This Molecule | [50] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | 1,25-dihydroxyvitamin D3 Drug Info | |
Structure | + | |||
Drug Combination 43 Up-regulating the Expression of This Molecule | [51] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Hesperetin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 44 Up-regulating the Expression of This Molecule | [52] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ferulic acid NP Info | + | Insulin Drug Info | |
Structure | + | |||
Drug Combination 45 Up-regulating the Expression of This Molecule | [53] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gossypol NP Info | + | Zoledronic Drug Info | |
Structure | + | |||
Drug Combination 46 Up-regulating the Expression of This Molecule | [54] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Thymoquinone NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 47 Up-regulating the Expression of This Molecule | [55] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Aspirin Drug Info | |
Structure | + | |||
Drug Combination 48 Up-regulating the Expression of This Molecule | [56] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Quercetin NP Info | + | 2-methoxyestradiol Drug Info | |
Structure | + | |||
Drug Combination 49 Up-regulating the Expression of This Molecule | [57] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gallic acid NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 50 Up-regulating the Expression of This Molecule | [58] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | Centchroman Drug Info | |
Structure | + | |||
Drug Combination 51 Up-regulating the Expression of This Molecule | [59] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Thymoquinone NP Info | + | Topotecan Drug Info | |
Structure | + | |||
Drug Combination 52 Up-regulating the Expression of This Molecule | [60] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Deferoxamine Drug Info | |
Structure | + | |||
Drug Combination 53 Up-regulating the Expression of This Molecule | [61] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Piperine NP Info | + | Mitomycin C Drug Info | |
Structure | + | |||
Drug Combination 54 Up-regulating the Expression of This Molecule | [62] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ellagic acid NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 55 Up-regulating the Expression of This Molecule | [63] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Artesunate NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 56 Up-regulating the Expression of This Molecule | [64] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Flavopiridol NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 57 Up-regulating the Expression of This Molecule | [65] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Betulinic Acid NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 58 Up-regulating the Expression of This Molecule | [66] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gossypol NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 59 Up-regulating the Expression of This Molecule | [67] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Elemene NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 60 Up-regulating the Expression of This Molecule | [68] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Luteolin NP Info | + | Oxaliplatin Drug Info | |
Structure | + | |||
Drug Combination 61 Up-regulating the Expression of This Molecule | [69] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Luteolin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 62 Up-regulating the Expression of This Molecule | [70] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 63 Up-regulating the Expression of This Molecule | [71] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Eugenol NP Info | + | 2-methoxyestradiol Drug Info | |
Structure | + | |||
Drug Combination 64 Up-regulating the Expression of This Molecule | [72] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 65 Up-regulating the Expression of This Molecule | [73] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Gefitinib Drug Info | |
Structure | + | |||
Drug Combination 66 Up-regulating the Expression of This Molecule | [74] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Noscapine NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 67 Up-regulating the Expression of This Molecule | [75] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Amentoflavone NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 68 Up-regulating the Expression of This Molecule | [76] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Thymoquinone NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 69 Up-regulating the Expression of This Molecule | [77] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Paclitaxel NP Info | + | Coralyne Drug Info | |
Structure | + | |||
Drug Combination 70 Up-regulating the Expression of This Molecule | [78] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Carboplatin Drug Info | |
Structure | + | |||
Drug Combination 71 Up-regulating the Expression of This Molecule | [79] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 72 Up-regulating the Expression of This Molecule | [80] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Nobiletin NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 73 Up-regulating the Expression of This Molecule | [81] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Noscapine NP Info | + | Gemcitabine Drug Info | |
Structure | + | |||
Drug Combination 74 Up-regulating the Expression of This Molecule | [82] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Cordycepin NP Info | + | Apatinib Drug Info | |
Structure | + | |||
Drug Combination 75 Up-regulating the Expression of This Molecule | [83] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Apigenin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 76 Up-regulating the Expression of This Molecule | [84] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 77 Up-regulating the Expression of This Molecule | [85] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Chrysin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 78 Up-regulating the Expression of This Molecule | [86] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 79 Up-regulating the Expression of This Molecule | [87] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Oridonin NP Info | + | Imatinib Drug Info | |
Structure | + | |||
Drug Combination 80 Up-regulating the Expression of This Molecule | [88] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Valproic acid Drug Info | |
Structure | + | |||
Drug Combination 81 Up-regulating the Expression of This Molecule | [89] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gambogic acid NP Info | + | Gefitinib Drug Info | |
Structure | + | |||
Drug Combination 82 Up-regulating the Expression of This Molecule | [90] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Cinnamaldehyde NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 83 Up-regulating the Expression of This Molecule | [91] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Bufalin NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 84 Up-regulating the Expression of This Molecule | [92] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Epigallocatechin gallate NP Info | + | Vorinostat Drug Info | |
Structure | + | |||
Drug Combination 85 Up-regulating the Expression of This Molecule | [93] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Thymoquinone NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 86 Up-regulating the Expression of This Molecule | [94] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Osthole NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 87 Up-regulating the Expression of This Molecule | [95] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Eugenol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 88 Up-regulating the Expression of This Molecule | [96] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 89 Up-regulating the Expression of This Molecule | [97] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | Selenite Drug Info | |
Structure | + | |||
Drug Combination 90 Up-regulating the Expression of This Molecule | [98] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | PD98059 Drug Info | |
Structure | + | |||
Drug Combination 91 Up-regulating the Expression of This Molecule | [99] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Celastrol NP Info | + | ABT-737 Drug Info | |
Structure | + | |||
Drug Combination 92 Up-regulating the Expression of This Molecule | [100] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Genistein NP Info | + | Cabazitaxel Drug Info | |
Structure | + | |||
Drug Combination 93 Up-regulating the Expression of This Molecule | [101] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Noscapine NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 94 Up-regulating the Expression of This Molecule | [102] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Emodin NP Info | + | Cytarabine Drug Info | |
Structure | + | |||
Drug Combination 95 Up-regulating the Expression of This Molecule | [103] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Saikosaponin D NP Info | + | SP600125 Drug Info | |
Structure | + | |||
Drug Combination 96 Up-regulating the Expression of This Molecule | [104] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Sulforaphane NP Info | + | Imatinib Drug Info | |
Structure | + | |||
Drug Combination 97 Up-regulating the Expression of This Molecule | [105] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Galangin NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 98 Up-regulating the Expression of This Molecule | [106] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Cyanidin-3-O-glucoside chloride NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 99 Up-regulating the Expression of This Molecule | [107] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Kaempferol NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 100 Up-regulating the Expression of This Molecule | [108] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Chlorogenic acid NP Info | + | Regorafenib Drug Info | |
Structure | + | |||
Drug Combination 101 Up-regulating the Expression of This Molecule | [98] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | PD184352 Drug Info | |
Structure | + | |||
Drug Combination 102 Up-regulating the Expression of This Molecule | [109] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Piperine NP Info | + | Celecoxib Drug Info | |
Structure | + | |||
Drug Combination 103 Up-regulating the Expression of This Molecule | [110] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Resveratrol NP Info | + | Temozolomide Drug Info | |
Structure | + | |||
Drug Combination 104 Up-regulating the Expression of This Molecule | [111] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 105 Up-regulating the Expression of This Molecule | [112] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Luteolin NP Info | + | Celecoxib Drug Info | |
Structure | + | |||
Drug Combination 106 Up-regulating the Expression of This Molecule | [7] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | 2-deoxy-D-glucose Drug Info | |
Structure | + | |||
Drug Combination 107 Up-regulating the Expression of This Molecule | [113] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Gilteritinib Drug Info | |
Structure | + | |||
Drug Combination 108 Up-regulating the Expression of This Molecule | [114] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Tetrandrine NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 109 Up-regulating the Expression of This Molecule | [115] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Furanodiene NP Info | + | Germacrone Drug Info | |
Structure | + | |||
Drug Combination 110 Up-regulating the Expression of This Molecule | [116] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Theaflavin-3,3'-digallate + Black tea polyphenol | + | Cisplatin | |
Click to Show/Hide the Each NP or Drug Structure of This Combination | ||||
Theaflavin-3,3'-digallate NP Info | Drug Info | |||
Black tea polyphenol NP Info | ||||
Drug Combination 111 Up-regulating the Expression of This Molecule | [117] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Metformin NP Info | + | Pemetrexed Drug Info | |
Structure | + | |||
Drug Combination 112 Up-regulating the Expression of This Molecule | [118] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Gingerol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure | + | |||
Drug Combination 113 Up-regulating the Expression of This Molecule | [119] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Arsenic trioxide NP Info | + | Polyinosinic acid-polycytidylic acid Drug Info | |
Structure | + | |||
Drug Combination 114 Up-regulating the Expression of This Molecule | [120] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Daidzein NP Info | + | Topotecan Drug Info | |
Structure | + | |||
Drug Combination 115 Up-regulating the Expression of This Molecule | [121] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Capsaicin NP Info | + | 3,3'-diindolylmethane Drug Info | |
Structure | + | |||
Drug Combination 116 Up-regulating the Expression of This Molecule | [9] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Curcumin NP Info | + | Doxorubicin Drug Info | |
Structure | + | |||
Drug Combination 117 Up-regulating the Expression of This Molecule | [122] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Brusatol NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 118 Up-regulating the Expression of This Molecule | [123] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Capsaicin NP Info | + | Sorafenib Drug Info | |
Structure | + | |||
Drug Combination 119 Up-regulating the Expression of This Molecule | [124] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Licochalcone A NP Info | + | 5-fluorouracil Drug Info | |
Structure | + | |||
Drug Combination 120 Up-regulating the Expression of This Molecule | [28] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Triptolide NP Info | + | Erlotinib Drug Info | |
Structure | + | |||
Drug Combination 121 Up-regulating the Expression of This Molecule | [125] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Ursolic acid NP Info | + | Cisplatin Drug Info | |
Structure | + | |||
Drug Combination 122 Up-regulating the Expression of This Molecule | [126] | |||
Detail(s) | Combination Info click to show the detail info of this combination | |||
Name | Borneol NP Info | + | Doxorubicin Drug Info | |
Structure | + |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | Cryptotanshinone | NP Info | Investigative | Salvia miltiorrhiza |
2 | Nobiletin | NP Info | Investigative | Ageratum conyzoides |