Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Estrogen receptor (ESR)
|
|||
| Synonyms |
Nuclear receptor subfamily 3 group A member 1; NR3A1; Estradiol receptor; ESR; ER-alpha; ER
|
|||
| Gene Name |
ESR1
|
|||
| Gene ID | ||||
| Sequence |
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV Click to Show/Hide
|
|||
| Function |
Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA-binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial association with multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF-kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA-binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited to the NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Isoform 3 is involved in activation of NOS3 and endothelial nitric oxide production. Isoforms lacking one or several functional domains are thought to modulate transcriptional activity by competitive ligand or DNA binding and/or heterodimerization with the full-length receptor. Essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3. Isoform 3 can bind to ERE and inhibit isoform 1.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Genistein NP Info | + | Tamoxifen Drug Info | |
| Structure |
|
+ |
|
|
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Genistein NP Info | + | 17-beta estradiol Drug Info | |
| Structure |
|
+ |
|
|
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | Atractylodes macrocephala | NP Info | Investigative | Atractylodes macrocephala |
| 2 | Daidzein | NP Info | Investigative | Glycine max |
| 3 | Ginsenoside Rh2 | NP Info | Investigative | Panax ginseng |
| 4 | Toremifene | NP Info | Approved | Homo sapiens |
| Drug(s) of This Target | ||||
|---|---|---|---|---|
| 1 | 4-hydroxy-tamoxifen | Drug Info | Phase 2 | Cyclic Mastalgia |
| 2 | 6-benzylthioinosine | Drug Info | Investigative | Acute myeloid leukemia |
| 3 | Bazedoxifene | Drug Info | Approved | Skeletal anomaly |
| 4 | Clomiphene citrate | Drug Info | Approved | Female infertility |
| 5 | Leptomycin B | Drug Info | Investigative | Lung cancer |
| 6 | Mitotane | Drug Info | Approved | Adrenal cancer |
| 7 | Raloxifene | Drug Info | Approved | Osteoporosis |
| 8 | Tamoxifen | Drug Info | Approved | Breast cancer |