Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Fatty acid-binding protein 3 (FABP3)
|
|||
| Synonyms |
Fatty acid-binding protein 3; Heart-type fatty acid-binding protein; H-FABP; Mammary-derived growth inhibitor; MDGI; Muscle fatty acid-binding protein; M-FABP; Fatty acid-binding protein, heart
|
|||
| Gene Name |
FABP3
|
|||
| Gene ID | ||||
| Sequence |
MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKN
TEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTH GTAVCTRTYEKEA Click to Show/Hide
|
|||
| Function |
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Glycine NP Info | + | Folfox Drug Info | |
| Structure |
|
+ |
|
|
| References | ||||
|---|---|---|---|---|
| Reference 1 | Dietary Glycine Prevents FOLFOX Chemotherapy-Induced Heart Injury: A Colorectal Cancer Liver Metastasis Treatment Model in Rats. Nutrients. 2020 Aug 28;12(9):2634. | |||