Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Metalloproteinase inhibitor 1 (TIMP1)
|
|||
| Synonyms |
Erythroid-potentiating activity; EPA; Fibroblast collagenase inhibitor; Collagenase inhibitor; Tissue inhibitor of metalloproteinases 1; TIMP-1
|
|||
| Gene Name |
TIMP1
|
|||
| Gene ID | ||||
| Sequence |
MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQR
YEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHIT TCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEK GFQSRHLACLPREPGLCTWQSLRSQIA Click to Show/Hide
|
|||
| Function |
Metalloproteinase inhibitor that functions by forming one to one complexes with target metalloproteinases, such as collagenases, and irreversibly inactivates them by binding to their catalytic zinc cofactor. Acts on MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16. Does not act on MMP14. Also functions as a growth factor that regulates cell differentiation, migration and cell death and activates cellular signaling cascades via CD63 and ITGB1. Plays a role in integrin signaling. Mediates erythropoiesis in vitro; but, unlike IL3, it is species-specific, stimulating the growth and differentiation of only human and murine erythroid progenitors.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Vitamin D NP Info | + | S-farnesylthiosalicylic acid Drug Info | |
| Structure |
|
+ |
|
|
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Docetaxel Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Up-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Up-regulating the Expression of This Molecule | [4] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Gemcitabine Drug Info | |
| Structure |
|
+ |
|
|