Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Forkhead box protein O3 (FOXO3)
|
|||
Synonyms |
AF6q21 protein; Forkhead in rhabdomyosarcoma-like 1
|
|||
Gene Name |
FOXO3
|
|||
Gene ID | ||||
Sequence |
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLS GGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTL SQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDG GKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSK PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLS HSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQT QGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFT GAKQASSQSWVPG Click to Show/Hide
|
|||
Function |
Transcriptional activator that recognizes and binds to the DNA sequence 5'-[AG]TAAA[TC]A-3' and regulates different processes, such as apoptosis and autophagy. Acts as a positive regulator of autophagy in skeletal muscle: in starved cells, enters the nucleus following dephosphorylation and binds the promoters of autophagy genes, such as GABARAP1L, MAP1LC3B and ATG12, thereby activating their expression, resulting in proteolysis of skeletal muscle proteins (By similarity). Triggers apoptosis in the absence of survival factors, including neuronal cell death upon oxidative stress. Participates in post-transcriptional regulation of MYC: following phosphorylation by MAPKAPK5, promotes induction of miR-34b and miR-34c expression, 2 post-transcriptional regulators of MYC that bind to the 3'UTR of MYC transcript and prevent its translation. In response to metabolic stress, translocates into the mitochondria where it promotes mtDNA transcription. In response to metabolic stress, translocates into the mitochondria where it promotes mtDNA transcription. Also acts as a key regulator of chondrogenic commitment of skeletal progenitor cells in response to lipid availability: when lipids levels are low, translocates to the nucleus and promotes expression of SOX9, which induces chondrogenic commitment and suppresses fatty acid oxidation (By similarity).
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Phosphorylation Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Phosphorylation of This Molecule | [1] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Apigenin NP Info | + | ABT-263 Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Vitexin NP Info | + | Doxorubicin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Up-regulating the Expression of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Resveratrol NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Up-regulating the Expression of This Molecule | [4] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Luteolin NP Info | + | Lapatinib Drug Info | |
Structure |
![]() |
+ |
![]() |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | Salvianolic acid A | NP Info | Investigative | Salvia |