Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Glycodelin (PAEP)
|
|||
Synonyms |
GD; Placental protein 14; PP14; Pregnancy-associated endometrial alpha-2 globulin; PAEG; PEG; Progestagen-associated endometrial protein; Progesterone-associated endometrial protein; Zona-binding inhibitory factor-1; ZIF-1
|
|||
Gene Name |
PAEP
|
|||
Gene ID | ||||
Sequence |
MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVH
ITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNF LFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF Click to Show/Hide
|
|||
Function |
Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities. Glycodelin-C stimulates binding of spermatozoa to the zona pellucida. Glycodelin-F inhibits spermatozoa-zona pellucida binding and significantly suppresses progesterone-induced acrosome reaction of spermatozoa. Glycodelin-S in seminal plasma maintains the uncapacitated state of human spermatozoa.
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Cleavage Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Cleavage of This Molecule | [1] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Elemene NP Info | + | Gefitinib Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Up-regulating the Cleavage of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Elemene NP Info | + | Oxaliplatin Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Up-regulating the Cleavage of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Gambogic acid NP Info | + | 5-fluorouracil Drug Info | |
Structure |
![]() |
+ |
![]() |