Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
G1/S-specific cyclin-E1 (CCNE1)
|
|||
| Synonyms |
G1/S-specific cyclin E; Cyclin E; CCNE
|
|||
| Gene Name |
CCNE1
|
|||
| Gene ID | ||||
| Sequence |
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIM LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNI QTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA Click to Show/Hide
|
|||
| Function |
Essential for the control of the cell cycle at the G1/S (start) transition.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | Mitomycin C Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Aspirin Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Honokiol NP Info | + | Rosiglitazone Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 4 Down-regulating the Expression of This Molecule | [4] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Piperine NP Info | + | Temozolomide Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 5 Down-regulating the Expression of This Molecule | [5] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Fisetin NP Info | + | Etoposide Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 6 Down-regulating the Expression of This Molecule | [6] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Pentagalloylglucose NP Info | + | 5-fluorouracil Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 7 Down-regulating the Expression of This Molecule | [7] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Ursolic acid NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|
| Up-regulation | Click to Show/Hide | |||
| Drug Combination 1 Up-regulating the Expression of This Molecule | [8] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Triptolide NP Info | + | Cisplatin Drug Info | |
| Structure |
|
+ |
|
|