Molecule Details
General Information of the Molecule | ||||
---|---|---|---|---|
Name |
Interleukin-10 (IL10)
|
|||
Synonyms |
IL-10; Cytokine synthesis inhibitory factor; CSIF
|
|||
Gene Name |
IL10
|
|||
Gene ID | ||||
Sequence |
MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN Click to Show/Hide
|
|||
Function |
Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric receptor comprising IL10RA and IL10RB leading to JAK1 and STAT2-mediated phosphorylation of STAT3. In turn, STAT3 translocates to the nucleus where it drives expression of anti-inflammatory mediators. Targets antigen-presenting cells (APCs) such as macrophages and monocytes and inhibits their release of pro-inflammatory cytokines including granulocyte-macrophage colony-stimulating factor /GM-CSF, granulocyte colony-stimulating factor/G-CSF, IL-1 alpha, IL-1 beta, IL-6, IL-8 and TNF-alpha. Interferes also with antigen presentation by reducing the expression of MHC-class II and co-stimulatory molecules, thereby inhibiting their ability to induce T cell activation. In addition, controls the inflammatory response of macrophages by reprogramming essential metabolic pathways including mTOR signaling (By similarity).
Click to Show/Hide
|
|||
Uniprot ID | ||||
Pfam | ||||
KEGG ID | ||||
TTD ID |
A List of Drug Combination(s) Able to Regulate This Molecule | ||||
---|---|---|---|---|
Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
Down-regulation | Click to Show/Hide | |||
Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Arsenic trioxide NP Info | + | Lenalidomide Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Curcumin NP Info | + | Anti-PD-1 antibody Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Acteoside NP Info | + | Dextran sulfate sodium Drug Info | |
Structure |
![]() |
+ |
![]() |
|
Up-regulation | Click to Show/Hide | |||
Drug Combination 1 Up-regulating the Expression of This Molecule | [4] | |||
Detail(s) |
Combination Info
![]() |
|||
Name | Glatiramer acetate NP Info | + | Atorvastatin Drug Info | |
Structure |
![]() |
+ |
![]() |
Natural Product(s) of This Target | ||||
---|---|---|---|---|
1 | Astilbin | NP Info | Investigative | Smilax glabra |