Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Proline-rich acidic protein 1 (PRAP1)
|
|||
| Synonyms |
Epididymis tissue protein Li 178; Uterine-specific proline-rich acidic protein
|
|||
| Gene Name |
PRAP1
|
|||
| Gene ID | ||||
| Sequence |
MRRLLLVTSLVVVLLWEAGAVPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLV
VLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGHVLSPEPDHDSLYHPPPEED QGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ Click to Show/Hide
|
|||
| Function |
May play an important role in maintaining normal growth homeostasis in epithelial cells.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Epigallocatechin gallate NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 2 Down-regulating the Expression of This Molecule | [2] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Fisetin NP Info | + | Cabazitaxel Drug Info | |
| Structure |
|
+ |
|
|
| Drug Combination 3 Down-regulating the Expression of This Molecule | [3] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Curcumin NP Info | + | TNF-related apoptosis inducing ligand Drug Info | |
| Structure |
|
+ |
|
|