Molecule Details
| General Information of the Molecule | ||||
|---|---|---|---|---|
| Name |
Programmed cell death 1 ligand 1 (PD-L1)
|
|||
| Synonyms |
hPD-L1; Programmed death ligand 1; PDL1; PDCD1LG1; PDCD1L1; PDCD1 ligand 1; B7H1; B7-H1; B7 homolog 1
|
|||
| Gene Name |
CD274
|
|||
| Gene ID | ||||
| Sequence |
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET Click to Show/Hide
|
|||
| Function |
As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response. Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10). Plays a critical role in induction and maintenance of immune tolerance to self.
Click to Show/Hide
|
|||
| Uniprot ID | ||||
| Pfam | ||||
| KEGG ID | ||||
| TTD ID | ||||
| A List of Drug Combination(s) Able to Regulate This Molecule | ||||
|---|---|---|---|---|
| Expression Regulation | Click to Show/Hide the Drug Combination Regulating This Molecule | |||
| Down-regulation | Click to Show/Hide | |||
| Drug Combination 1 Down-regulating the Expression of This Molecule | [1] | |||
| Detail(s) |
Combination Info
click to show the detail info of this combination
|
|||
| Name | Honokiol NP Info | + | Rapamycin Drug Info | |
| Structure |
|
+ |
|
|
| Natural Product(s) of This Target | ||||
|---|---|---|---|---|
| 1 | 5,7,4'-Trimethoxyflavone | NP Info | . | Not Available |
| 2 | Baohuoside I | NP Info | . | Not Available |
| 3 | Morin | NP Info | Investigative | Morus serrata |
| 4 | Paclitaxel | NP Info | Approved | Taxus brevifolia |
| 5 | Tricin | NP Info | Investigative | Ephedra sinica |
| Drug(s) of This Target | ||||
|---|---|---|---|---|
| 1 | 10058F4 | Drug Info | Investigative | Acute myeloid leukemia |
| 2 | Anti-PD-1 antibody | Drug Info | Approved | Melanoma |